Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.

Search Within Results

4,351 – 4,365 of 1,824,489 results

4,351

Invitrogen™ ACSL6 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P33124, Q91WC3, Q9UKU0
Isotype	IgG
Concentration	1 mg/mL
Antigen	ACSL6
Gene Symbols	Acsl6
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	A330035H04Rik; ACS2; ACSL6; acyl-CoA synthetase long-chain family member 6; Arachidonate--CoA ligase; AW050338; FACL6; fatty acid Coenzyme A ligase, long chain 6; fatty-acid-Coenzyme A ligase, long-chain 6; KIAA0837; L LACS5; LACS; LACS 6; LACS2; LACS5; Lacsl; long fatty acyl-CoA synthetase 2; long-chain acyl-CoA synthetase 6; Long-chain-fatty-acid--CoA ligase 6; long-chain-fatty-acid--CoA ligase, brain isozyme; mKIAA0837
Gene	Acsl6
Product Type	Antibody
Gene ID (Entrez)	117243, 216739, 23305
Formulation	0.1M tris glycine with 20% glycerol and 0.01% thimerosal; pH 7
Immunogen	Recombinant protein encompassing a sequence within the C-terminus region of human ACSL6. The exact sequence is proprietary.
Classification	Polyclonal
Primary or Secondary	Primary

4,352

CD106 (VCAM-1) Monoclonal Antibody (429), Biotin, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	Biotin
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P29533
Concentration	0.5 mg/mL
Antigen	CD106 (VCAM-1)
Gene Symbols	VCAM1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	adhesion molecule VCAM-1; CD106; CD106 antigen; DKFZp779G2333; INCAM100; INCAM-100; MGC99561; sCD106; soluble CD106; soluble VCAM 1; sVCAM 1; vascular cell adhesion molecule; vascular cell adhesion molecule 1; vascular cell adhesion molecule-1; vascular cell adhesion protein 1; V-CAM 1; Vcam1; Vcam-1; VCAM1B
Gene	VCAM1
Product Type	Antibody
Gene ID (Entrez)	22329
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	429

4,353

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	-20°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	Flow Cytometry,Immunocytochemistry,Immunohistochemistry (Paraffin),Western Blot
Form	Lyophilized
Gene Accession No.	P37173
Isotype	IgG2b
Concentration	500 μg/mL
Antigen	TGFBR2
Gene Symbols	TGFBR2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	1110020H15Rik; AAT3; AU042018; DNIIR; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; RIIDN; TAAD2; TbetaRII; TbetaR-II; TBR-II; tgf beta receptor 2; TGF-beta 2; TGF-beta receptor II; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGFbeta RII; TGFbeta type II receptor; TGF-beta type II receptor; TGFbeta-RII; TGFBR2; Tgfbr2T; TGFR2; TGFR-2; transforming growth factor beta receptor 2; transforming growth factor beta receptor II; transforming growth factor beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor 2; transforming growth factor, beta receptor II; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; transforming growth factor, beta receptor IIT; transforming growth factor-b type II receptor; transforming growth factor-beta receptor type II; transforming growth factor-beta type II receptor
Gene	TGFBR2
Product Type	Antibody
Gene ID (Entrez)	7048
Formulation	PBS with 4mg trehalose and no preservative
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2F11

4,354

IL-17A Monoclonal Antibody (eBio64DEC17), Brilliant Violet™ 786, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 786
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	Q16552
Concentration	5 μL/Test
Antigen	IL-17A
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	Ctla8; CTLA-8; cytokine; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; il 17; Il17; IL-17; IL17A; IL-17a; ILN; Interleukin; interleukin 17; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin 17 precursor; interleukin 17A; interleukin-17; Interleukin17A; interleukin-17A; R-IL-17-A
Gene	IL17A
Product Type	Antibody
Gene ID (Entrez)	3605
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio64DEC17

4,355

Invitrogen™ SOX2 Monoclonal Antibody (20G5), DyLight™ 488

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, do not freeze
Target Species	Human,Mouse
Host Species	Mouse
Conjugate	DyLight 488
Applications	Immunocytochemistry
Form	Liquid
Gene Accession No.	P48431, P48432
Isotype	IgG1 κ
Concentration	1 mg/mL
Antigen	SOX2
Gene Symbols	SOX2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	ANOP3; cb236; Delta EF2a; lcc; MCOPS3; MCOPS3 (Microphthalmia Syndromic type 3); RGD1565646; sex determining region Y-box 2; SOX 2; SOX2; Sox-2; soxp; SRY (sex determining region Y) box 2; SRY (sex determining region Y)-box 2; SRY box 2; SRY related HMG box 2; SRY-box 2; SRY-box 2; SOX2; SRY-box containing gene 2; SRY-box transcription factor 2; SRY-related HMG-box gene 2; transcription factor SOX2; transcription factor SOX-2; wu:fb83g04; wu:fc14d07; ysb; zgc:65860; zgc:77389
Gene	SOX2
Product Type	Antibody
Gene ID (Entrez)	20674, 6657
Formulation	PBS with proprietary stabilizer and 0.02% sodium azide; pH 7.4
Immunogen	Full-length human recombinant protein expressed in bacteria.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	20G5

4,356

Invitrogen™ NF-H Recombinant Superclonal™ Antibody (4HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Frozen),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	P12036, P16884, P19246
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	NF-H
Gene Symbols	Nefh
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	200 kDa neurofilament protein; CMT2CC; heavy neurofilament protein; I79_012512; intermediate filament protein; KIAA0845; LOW QUALITY PROTEIN: neurofilament heavy polypeptide; mKIAA0845; NEF3; Nefh; nefh.L; neurofilament; neurofilament 200kDa; neurofilament heavy; neurofilament heavy L homeolog; neurofilament heavy polypeptide; neurofilament heavy polypeptide-like; neurofilament triplet H protein; neurofilament, heavy polypeptide; neurofilament, heavy polypeptide 200kDa; neurofilament, heavy polypeptide L homeolog; neurofilament-H; NF 200 kD; NF200; Nfh; NF-H; NHC; XELAEV_18007418mg
Gene	Nefh
Product Type	Antibody
Gene ID (Entrez)	24587, 380684, 4744
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Peptide corresponding to Human NEFH (aa 631-643).
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	4HCLC

4,357

IgM Monoclonal Antibody (eB121-15F9), FITC, eBioscience™, Invitrogen™

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Mouse
Host Species	Rat
Conjugate	FITC
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01872
Concentration	0.5 mg/mL
Antigen	Mouse IgM
Gene Symbols	Ighm
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AGM1; AI326478; Igh6; Igh-6; Ighm; Igh-M; Igm; immunoglobulin heavy constant mu; MU; muH; VH
Gene	Ighm
Product Type	Antibody
Gene ID (Entrez)	16019
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eB121-15F9

4,358

Invitrogen™ LTBR Monoclonal Antibody (5G11)

Rat Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Mouse
Host Species	Rat
Conjugate	Unconjugated
Applications	Flow Cytometry,Functional Assay,Inhibition Assays,Western Blot
Form	Liquid
Gene Accession No.	P50284
Isotype	IgG2a
Concentration	100 μg/mL
Antigen	LTBR
Gene Symbols	Ltbr
Regulatory Status	RUO
Purification Method	Protein G
Gene Alias	AI256028; CD18; D12S370; LT beta-R; Ltar; LT-beta receptor; LTbetaR; LT-BETA-R; Ltbr; lymphotoxin B receptor; lymphotoxin beta receptor; lymphotoxin beta receptor (TNFR superfamily, member 3); lymphotoxin-beta receptor; TNF receptor-related protein; Tnfbr; TNFCR; TNFR2-RP; TNFR3; TNF-RIII; TNF-R-III; TNFR-III; TNFRrp; TNFR-RP; Tnfrsf3; Tumor necrosis factor C receptor; tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; tumor necrosis factor receptor superfamily, member 3; tumor necrosis factor receptor type III
Gene	Ltbr
Product Type	Antibody
Gene ID (Entrez)	17000
Formulation	PBS with 0.1% BSA and no preservative
Immunogen	Drosophila S2 expressed mouse LTbR Ig fusion protein.
Classification	Monoclonal
Primary or Secondary	Primary
Clone	5G11

4,359

CD20 Monoclonal Antibody (2H7), Brilliant Violet™ 650, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Brilliant Violet 650
Applications	Flow Cytometry
Form	Liquid
Isotype	IgG2b κ
Gene Accession No.	P11836
Concentration	5 μL/Test
Antigen	CD20
Gene Symbols	Ms4a1
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	AA960661; APY; ATOPY; B1; B-cell differentiation antigen Ly-44; B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1; B-lymphocyte surface antigen B1; Bp35; Cd20; CD20 antigen; CD20 cell surface protein; CD20 receptor; CVID5; EGK_06167; Fc epsilon receptor I beta chain; Fc Fragment of IgE high affinity I receptor for beta polypeptide; FCER1B; High affinity immunoglobulin epsilon receptor subunit beta; IgE Fc receptor subunit beta; IGEL; IGER; IGHER; LEU16; LEU-16; Leukocyte surface antigen Leu-16; Ly44; Ly-44; Lymphocyte antigen 44; membrane spanning 4-domains A1; membrane-spanning 4-domains subfamily A member 1; membrane-spanning 4-domains, subfamily A, member 1; membrane-spanning 4-domains, subfamily A, member 2; MGC3969; MS4A1; MS4A2; S7
Gene	Ms4a1
Gene ID (Entrez)	931
Formulation	PBS with BSA and 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	2H7

4,360

Invitrogen™ IDH2 Recombinant Superclonal™ Antibody (8 HCLC)

Rabbit Recombinant Superclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot
Form	Liquid
Gene Accession No.	P48735, P54071, P56574
Isotype	IgG
Concentration	0.5 mg/mL
Antigen	IDH2
Gene Symbols	Idh2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	D2HGA2; E430004F23; ICD-M; IDH; Idh2; Idh-2; IDHM; IDP; IDPM; isocitrate dehydrogenase (NADP(+)) 2; isocitrate dehydrogenase (NADP(+)) 2, mitochondrial; isocitrate dehydrogenase [NADP], mitochondrial; isocitrate dehydrogenase 2 (NADP+), mitochondrial; mNADP-IDH; NADP(+)-specific ICDH; NADP+-specific ICDH; NADP+-specific isocitrate dehydrogenase; NADPH-specific isocitrate dehydrogenase; oxalosuccinate decarboxylase
Gene	Idh2
Product Type	Antibody
Gene ID (Entrez)	269951, 3418, 361596
Formulation	PBS with 0.09% sodium azide; pH 7.2-7.4
Immunogen	Protein corresponding to human IDH2 [aa41-aa452].
Classification	Recombinant Superclonal
Primary or Secondary	Primary
Clone	8 HCLC

4,361

Invitrogen™ AcmNPV gp64 Monoclonal Antibody (M001)

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Virus
Host Species	Mouse
Conjugate	Unconjugated
Applications	Neutralization
Form	Liquid
Isotype	IgG1
Concentration	10.02 mg/mL
Antigen	AcmNPV gp64
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	Gp64
Product Type	Antibody
Formulation	Arginine, histidine with 0.02% Tween 80, 120mM NaCl and no preservative; pH 6.0
Immunogen	Recombinant Autographa californica nucleopolyhedrovirus (AcNPV)(strain E2).
Classification	Monoclonal
Primary or Secondary	Primary
Clone	M001

4,362

Invitrogen™ ALDH1A2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	O94788
Isotype	IgG
Concentration	0.1 mg/mL
Antigen	ALDH1A2
Gene Symbols	ALDH1A2
Regulatory Status	RUO
Purification Method	Antigen affinity chromatography
Gene Alias	AL1A2; alcohol dehydrogenase family 1, subfamily A2; alcohol dehydrogenase family 1, subfamily A7; aldehyde dehydrogenase 1 family member A2; aldehyde dehydrogenase 1 family, member A2; aldehyde dehydrogenase 1A2; aldehyde dehydrogenase family 1 member A2; aldehyde dehydrogenase family 1, subfamily A2; Aldh1a2; Aldh1a7; AV116159; fb50h01; neckless; nls; nof; no-fin; RALDH 2; RALDH(II); Raldh1; RALDH2; Raldh-2; RALDH2-T; retinal dehydrogenase 2; retinal dehydrogenase, type II; retinaldehyde dehydrogenase 2; retinaldehyde dehydrogenase type 2; retinaldehyde-specific dehydrogenase type 2
Gene	ALDH1A2
Product Type	Antibody
Gene ID (Entrez)	8854
Formulation	PBS with 40% glycerol and 0.02% sodium azide; pH 7.2
Immunogen	Recombinant protein corresponding to Human ALDH1A2. Recombinant protein control fragment (Product #RP-89838).
Classification	Polyclonal
Primary or Secondary	Primary

4,363

Invitrogen™ MUC2 Recombinant Rabbit Monoclonal Antibody (HL1724)

Rabbit Recombinant Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Immunohistochemistry (Paraffin),Western Blot,Immunocytochemistry
Form	Liquid
Gene Accession No.	Q02817, Q62635, Q80Z19
Isotype	IgG
Concentration	1 mg/mL
Antigen	MUC2
Gene Symbols	MUC2
Regulatory Status	RUO
Purification Method	Protein A
Gene Alias	2010015E03Rik; colonic mucin; HH-Muc; intestinal mucin-2; MCM; MLP; muc2; MUC-2; mucin 2; mucin 2, intestinal/tracheal; mucin 2, oligomeric mucus/gel-forming; mucin-2; mucin-like protein; secreted gel-forming mucin; SMUC; wnn
Gene	MUC2
Product Type	Antibody
Gene ID (Entrez)	17831, 24572, 4583
Formulation	PBS with no preservative
Immunogen	Synthtic peptide of human MUC2.
Classification	Recombinant Monoclonal
Primary or Secondary	Primary
Clone	HL1724

4,364

CD8a Monoclonal Antibody (AMC908), Alexa Fluor™ 488, eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C, store in dark, DO NOT FREEZE!
Target Species	Human
Host Species	Mouse
Conjugate	Alexa Fluor 488
Applications	Immunohistochemistry (Paraffin),Immunocytochemistry
Form	Liquid
Isotype	IgG2a κ
Gene Accession No.	P01732, P10966
Concentration	0.5 mg/mL
Antigen	CD8a
Gene Symbols	Cd8a, CD8B
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	BB154331; CD8; CD8 alpha; CD8 alpha chain; CD8 alpha chain precursor; CD8 antigen; CD8 antigen 32 kDa chain; CD8 antigen 37 kDa chain; CD8 antigen alpha polypeptide; CD8 antigen alpha protein; CD8 antigen alpha protein precursor; CD8 antigen alpha-chain; CD8 antigen beta polypeptide; CD8 antigen beta polypeptide precursor; CD8 antigen beta-chain; CD8 antigen, alpha chain; CD8 antigen, alpha polypeptide; CD8 antigen, alpha polypeptide (p32); CD8 antigen, alpha-chain; CD8 antigen, beta chain; CD8 antigen, beta chain 1; CD8 antigen, beta polypeptide; CD8 antigen, beta polypeptide 1 (p37); CD8 antigen, beta-chain; CD8 beta; CD8 beta chain; CD8 beta-2; CD8a; CD8A antigen alpha; CD8a molecule; CD8A; T-cell surface glycoprotein; CD8alpha; CD8B; CD8b antigen; CD8b molecule; CD8b molecule pseudogene; Cd8b1; CD8beta; CD8BP; fCD8; LEU2; Leu-2; Leu2 T-lymphocyte antigen; leu-2a; Ly-2; LY3; Ly-3; Ly-35; Ly-B; Ly-C; Lymphocyte antigen 3; Lyt2; Lyt-2; Lyt-2.1 lymphocyte differentiation antigen (AA at 100); Lyt3; Lyt-3; MAL; membrane glycoprotein; membrane protein; OKT8 T-cell antigen; OX-8 membrane antigen; p32; P37; RHACD8-4; T cell co-receptor; T lymphocyte surface glycoprotein beta chain; T8 T-cell antigen; T-cell antigen Leu2; T-cell membrane glycoprotein Ly-3; T-cell surface glycoprotein; T-cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 beta chain; T-cell surface glycoprotein Lyt-2; T-cell surface glycoprotein Lyt-3; T-cell surface molecule; T-lymphocyte differentiation antigen T8/Leu-2; type I transmembrane glycoprotein
Gene	CD8B
Product Type	Antibody
Gene ID (Entrez)	925, 926
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	AMC908

4,365

IL-21 Monoclonal Antibody (eBio3A3-N2 (3A3-N2)), eBioscience™, Invitrogen™

Mouse Monoclonal Antibody

Pricing & Availability
Specifications

Content And Storage	4°C
Target Species	Human
Host Species	Mouse
Conjugate	Unconjugated
Applications	ELISA
Form	Liquid
Isotype	IgG1 κ
Gene Accession No.	Q9HBE4
Concentration	0.5 mg/mL
Antigen	IL-21
Gene Symbols	IL21
Regulatory Status	RUO
Purification Method	Affinity chromatography
Gene Alias	CVID11; CX2; il 21; IL21; IL-21; ILN; Interleukin; interleukin 21; Interleukin21; interleukin-21; interleukin-21 isoform; porcine interleukin-21; Za11
Gene	IL21
Product Type	Antibody
Gene ID (Entrez)	59067
Formulation	PBS with 0.09% sodium azide; pH 7.2
Classification	Monoclonal
Primary or Secondary	Primary
Clone	eBio3A3-N2 (3A3-N2)

Primary Antibodies

Filtered Search Results

Narrow Results

Invitrogen™ ACSL6 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD106 (VCAM-1) Monoclonal Antibody (429), Biotin, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-17A Monoclonal Antibody (eBio64DEC17), Brilliant Violet™ 786, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ SOX2 Monoclonal Antibody (20G5), DyLight™ 488 Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IgM Monoclonal Antibody (eB121-15F9), FITC, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ LTBR Monoclonal Antibody (5G11) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD20 Monoclonal Antibody (2H7), Brilliant Violet™ 650, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ AcmNPV gp64 Monoclonal Antibody (M001) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ALDH1A2 Polyclonal Antibody Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ MUC2 Recombinant Rabbit Monoclonal Antibody (HL1724) Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

CD8a Monoclonal Antibody (AMC908), Alexa Fluor™ 488, eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

IL-21 Monoclonal Antibody (eBio3A3-N2 (3A3-N2)), eBioscience™, Invitrogen™ Greener ChoiceOffers one or more environmental benefits itemized in the U.S. FTC “Green Guides.”Learn More

Invitrogen™ ACSL6 Polyclonal Antibody

CD106 (VCAM-1) Monoclonal Antibody (429), Biotin, eBioscience™, Invitrogen™

Invitrogen™ TGFBR2 Monoclonal Antibody (2F11)

IL-17A Monoclonal Antibody (eBio64DEC17), Brilliant Violet™ 786, eBioscience™, Invitrogen™

Invitrogen™ SOX2 Monoclonal Antibody (20G5), DyLight™ 488

IgM Monoclonal Antibody (eB121-15F9), FITC, eBioscience™, Invitrogen™

Invitrogen™ LTBR Monoclonal Antibody (5G11)

CD20 Monoclonal Antibody (2H7), Brilliant Violet™ 650, eBioscience™, Invitrogen™

Invitrogen™ AcmNPV gp64 Monoclonal Antibody (M001)

Invitrogen™ ALDH1A2 Polyclonal Antibody

Invitrogen™ MUC2 Recombinant Rabbit Monoclonal Antibody (HL1724)

CD8a Monoclonal Antibody (AMC908), Alexa Fluor™ 488, eBioscience™, Invitrogen™

IL-21 Monoclonal Antibody (eBio3A3-N2 (3A3-N2)), eBioscience™, Invitrogen™